PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_030459
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WRKY
Protein Properties Length: 288aa    MW: 32036.7 Da    PI: 7.1131
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_030459genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.33.3e-33127184158
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                  ldDgy+WrKYGqK vk+s+fprsYYrCts++C v k+vers++dp++v++tYeg+Hnh
  DCAR_030459 127 LDDGYRWRKYGQKAVKNSPFPRSYYRCTSTTCGVLKRVERSSTDPSIVVTTYEGNHNH 184
                  59******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.7E-33112185IPR003657WRKY domain
SuperFamilySSF1182903.79E-28119185IPR003657WRKY domain
PROSITE profilePS5081131.353122187IPR003657WRKY domain
SMARTSM007744.8E-38127186IPR003657WRKY domain
PfamPF031063.0E-26128184IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MKNSSAFFDD SGFSFASLSD GEKRLLDMLG SEDMLNQPSS IYDLIQVPSV QEPQQPVETS  60
EVVNDAETPN SSSICTSSND AVKDDQQSKR STQGGKPKKM LKAEKKIAKK QREPRVAFMT  120
RTDIDHLDDG YRWRKYGQKA VKNSPFPRSY YRCTSTTCGV LKRVERSSTD PSIVVTTYEG  180
NHNHLCPVAH PGAMGISPEP YSLRGDALST QQRLQQQSIQ HLLQLQQQPY TISPASFSNS  240
RATSYSPLDA PTHVLEENEL SFSPSSLFRD QGLLQDMVSS QMQSEKK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-271201871077Probable WRKY transcription factor 4
1wj2_A1e-271201871077Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9FGZ44e-45WRK48_ARATH; Probable WRKY transcription factor 48
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13092479
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.14e-42WRKY DNA-binding protein 48